PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G138500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 215aa    MW: 23399.6 Da    PI: 8.9782
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G138500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.2e-42421411100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l
  Manes.07G138500.1.p  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSL 131
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael+++++e
  Manes.07G138500.1.p 132 QAELNAVRAE 141
                          ******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81341142IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4242139IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MSRERERFEE IGKKIKRETD ASSQMGRRHM LGPPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLMEV PESQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISALQQQVQS LQAELNAVRA EILKYKYREA NILPSSHVAL LSSGAVSVAT PSSSLPPPTP  180
PPPPTSSSSS IYTHQPTSVT DFSTISNENV SFFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520837.11e-132PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T52e-89LBD15_ARATH; LOB domain-containing protein 15
TrEMBLB9S4B81e-132B9S4B8_RICCO; LOB domain-containing protein, putative
STRINGVIT_13s0067g02380.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-87LOB domain-containing protein 15